Lineage for d3ffkb2 (3ffk B:147-368)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1857402Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1857787Protein automated matches [226905] (12 species)
    not a true protein
  7. 1857890Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (9 PDB entries)
  8. 1857901Domain d3ffkb2: 3ffk B:147-368 [246111]
    Other proteins in same PDB: d3ffka1, d3ffka2, d3ffka3, d3ffkb1, d3ffkd1, d3ffkd2, d3ffkd3, d3ffke1
    automated match to d1c0fa2
    complexed with atp, ca

Details for d3ffkb2

PDB Entry: 3ffk (more details), 3 Å

PDB Description: crystal structure of human gelsolin domains g1-g3 bound to actin
PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d3ffkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ffkb2 c.55.1.1 (B:147-368) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagps

SCOPe Domain Coordinates for d3ffkb2:

Click to download the PDB-style file with coordinates for d3ffkb2.
(The format of our PDB-style files is described here.)

Timeline for d3ffkb2: