SCOP 1.55: Domain d1rl2b1: 1rl2 B:126-196

Lineage for d1rl2b1 (1rl2 B:126-196)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.34: SH3-like barrel [50036] (7 superfamilies)

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (3 families)

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [50116] (1 PDB entry)

8. Domain d1rl2b1: 1rl2 B:126-196 [24611]
   Other proteins in same PDB: d1rl2a2, d1rl2b2

Details for d1rl2b1

PDB Entry: 1rl2, 2.3 Å

PDB Description: ribosomal protein l2 rna-binding domain from bacillus stearothermophilus

SCOP Domain Sequences for d1rl2b1:

Sequence; same for both SEQRES and ATOM records:

>d1rl2b1 b.34.5.3 (B:126-196) C-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus}
gnalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasgevrmilg
kcratvgevgn

Timeline for d1rl2b1:

• d1rl2b1 appears in SCOP 1.57
  
• d1rl2b1 appears in the current release, SCOPe 2.08