Class b: All beta proteins [48724] (93 folds) |
Fold b.34: SH3-like barrel [50036] (7 superfamilies) |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (3 families) |
Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein) |
Protein C-terminal domain of ribosomal protein L2 [50115] (2 species) |
Species Bacillus stearothermophilus [TaxId:1422] [50116] (1 PDB entry) |
Domain d1rl2b1: 1rl2 B:126-196 [24611] Other proteins in same PDB: d1rl2a2, d1rl2b2 |
PDB Entry: 1rl2 (more details), 2.3 Å
SCOP Domain Sequences for d1rl2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rl2b1 b.34.5.3 (B:126-196) C-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus} gnalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasgevrmilg kcratvgevgn
Timeline for d1rl2b1: