SCOPe 2.05: Domain d1rl2a1: 1rl2 A:126-195

Lineage for d1rl2a1 (1rl2 A:126-195)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [50116] (1 PDB entry)

8. Domain d1rl2a1: 1rl2 A:126-195 [24610]
   Other proteins in same PDB: d1rl2a2, d1rl2b2

Details for d1rl2a1

PDB Entry: 1rl2, 2.3 Å

PDB Description: ribosomal protein l2 rna-binding domain from bacillus stearothermophilus

PDB Compounds: (A:) protein (ribosomal protein l2)

SCOPe Domain Sequences for d1rl2a1:

Sequence; same for both SEQRES and ATOM records:

>d1rl2a1 b.34.5.3 (A:126-195) C-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus [TaxId: 1422]}
gnalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasgevrmilg
kcratvgevg

Timeline for d1rl2a1:

• d1rl2a1 first appeared (with stable ids) in SCOP 1.55
  
• d1rl2a1 appears in SCOPe 2.04
  
• d1rl2a1 appears in SCOPe 2.06
  
• d1rl2a1 appears in the current release, SCOPe 2.08