SCOPe 2.04: Domain d3fdca_: 3fdc A:

Lineage for d3fdca_ (3fdc A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (24 PDB entries)

8. Domain d3fdca_: 3fdc A: [246091]
   automated match to d4i60a_
   complexed with btf

Details for d3fdca_

PDB Entry: 3fdc, 3.1 Å

PDB Description: Crystal Structure of Avidin

PDB Compounds: (A:) Avidin

SCOPe Domain Sequences for d3fdca_:

Sequence, based on SEQRES records:

>d3fdca_ b.61.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
csltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqpt
fgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl

Sequence, based on observed residues (ATOM records):

>d3fdca_ b.61.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
csltgkwtndlgsnmtigavnsrgeftgtyttavtatneikesplhgtentinkrtqptf
gftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl

Timeline for d3fdca_:

• d3fdca_ is new in SCOPe 2.04-stable
  
• d3fdca_ appears in SCOPe 2.05
  
• d3fdca_ appears in the current release, SCOPe 2.08