SCOP 1.59: Domain d1bkb_1: 1bkb 4-74

Lineage for d1bkb_1 (1bkb 4-74)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.34: SH3-like barrel [50036] (9 superfamilies)

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (3 families)

5. Family b.34.5.2: N-terminal domain of eukaryotic initiation translation factor 5a [50110] (1 protein)

6. Protein N-terminal domain of eukaryotic initiation translation factor 5a [50111] (2 species)

7. Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [50113] (1 PDB entry)

8. Domain d1bkb_1: 1bkb 4-74 [24609]
   Other proteins in same PDB: d1bkb_2

Details for d1bkb_1

PDB Entry: 1bkb, 1.75 Å

PDB Description: initiation factor 5a from archebacterium pyrobaculum aerophilum

SCOP Domain Sequences for d1bkb_1:

Sequence; same for both SEQRES and ATOM records:

>d1bkb_1 b.34.5.2 (4-74) N-terminal domain of eukaryotic initiation translation factor 5a {Archaeon Pyrobaculum aerophilum}
kwvmstkyveagelkegsyvvidgepcrvveieksktgkhgsakarivavgvfdggkrtl
slpvdaqvevp

Timeline for d1bkb_1:

• d1bkb_1 first appeared (with stable ids) in SCOP 1.55
  
• d1bkb_1 appears in SCOP 1.57
  
• d1bkb_1 appears in SCOP 1.61
  
• d1bkb_1 appears in the current release, SCOPe 2.08, called d1bkba1