Lineage for d3fcyb_ (3fcy B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2510637Species Thermoanaerobacterium sp. [TaxId:60708] [255827] (1 PDB entry)
  8. 2510639Domain d3fcyb_: 3fcy B: [246087]
    automated match to d1l7aa_
    complexed with ca

Details for d3fcyb_

PDB Entry: 3fcy (more details), 2.1 Å

PDB Description: crystal structure of acetyl xylan esterase 1 from thermoanaerobacterium sp. jw/sl ys485
PDB Compounds: (B:) Xylan esterase 1

SCOPe Domain Sequences for d3fcyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fcyb_ c.69.1.0 (B:) automated matches {Thermoanaerobacterium sp. [TaxId: 60708]}
fdmplqklreytgtnpcpedfdeywnraldemrsvdpkielkessfqvsfaecydlyftg
vrgarihakyikpktegkhpalirfhgyssnsgdwndklnyvaagftvvamdvrgqggqs
qdvggvtgntlnghiirgldddadnmlfrhifldtaqlagivmnmpevdedrvgvmgpsq
ggglslacaaleprvrkvvseypflsdykrvwdldlaknayqeitdyfrlfdprherene
vftklgyidvknlakrikgdvlmcvglmdqvcppstvfaaynniqskkdikvypdyghep
mrgfgdlamqfmlelys

SCOPe Domain Coordinates for d3fcyb_:

Click to download the PDB-style file with coordinates for d3fcyb_.
(The format of our PDB-style files is described here.)

Timeline for d3fcyb_: