SCOPe 2.04: Domain d3fcjd2: 3fcj D:261-433

Lineage for d3fcjd2 (3fcj D:261-433)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)

6. Protein automated matches [231931] (2 species)
   not a true protein

7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [231932] (6 PDB entries)

8. Domain d3fcjd2: 3fcj D:261-433 [246085]
   Other proteins in same PDB: d3fcja1, d3fcjb1, d3fcjc1, d3fcjd1
   automated match to d3d9da2
   complexed with fad, gol, nie; mutant

Details for d3fcjd2

PDB Entry: 3fcj, 2.4 Å

PDB Description: nitroalkane oxidase: mutant402n crystallized with nitroethane

PDB Compounds: (D:) nitroalkane oxidase

SCOPe Domain Sequences for d3fcjd2:

Sequence; same for both SEQRES and ATOM records:

>d3fcjd2 a.29.3.1 (D:261-433) automated matches {Fungus (Fusarium oxysporum) [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfnggniglrrrqmqrvmaledyepwaatygssk

Timeline for d3fcjd2:

• d3fcjd2 is new in SCOPe 2.04-stable
  
• d3fcjd2 appears in SCOPe 2.05
  
• d3fcjd2 appears in the current release, SCOPe 2.08