Class a: All alpha proteins [46456] (285 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins) |
Protein automated matches [231931] (2 species) not a true protein |
Species Fungus (Fusarium oxysporum) [TaxId:5507] [231932] (6 PDB entries) |
Domain d3fcja2: 3fcj A:261-432 [246079] Other proteins in same PDB: d3fcja1, d3fcjb1, d3fcjc1, d3fcjd1 automated match to d3d9da2 complexed with fad, gol, nie; mutant |
PDB Entry: 3fcj (more details), 2.4 Å
SCOPe Domain Sequences for d3fcja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fcja2 a.29.3.1 (A:261-432) automated matches {Fungus (Fusarium oxysporum) [TaxId: 5507]} pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk syakdmsfprllnevmcyplfnggniglrrrqmqrvmaledyepwaatygss
Timeline for d3fcja2: