Lineage for d3fb6b2 (3fb6 B:108-212)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (510 PDB entries)
  8. 2354317Domain d3fb6b2: 3fb6 B:108-212 [246073]
    Other proteins in same PDB: d3fb6b1, d3fb6c_
    automated match to d4ma7l2
    complexed with k

Details for d3fb6b2

PDB Entry: 3fb6 (more details), 3 Å

PDB Description: KcsA Potassium channel in the partially open state with 16 A opening at T112
PDB Compounds: (B:) antibody fab fragment light chain

SCOPe Domain Sequences for d3fb6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fb6b2 b.1.1.2 (B:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d3fb6b2:

Click to download the PDB-style file with coordinates for d3fb6b2.
(The format of our PDB-style files is described here.)

Timeline for d3fb6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fb6b1
View in 3D
Domains from other chains:
(mouse over for more information)
d3fb6c_