Lineage for d2eifa1 (2eif A:4-73)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377951Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2378092Family b.34.5.2: eIF5a N-terminal domain-like [50110] (3 protein domains)
  6. 2378097Protein Eukaryotic initiation translation factor 5a (eIF5a) [50111] (5 species)
  7. 2378100Species Methanococcus jannaschii [TaxId:2190] [50112] (2 PDB entries)
  8. 2378101Domain d2eifa1: 2eif A:4-73 [24607]
    Other proteins in same PDB: d2eifa2, d2eifa3

Details for d2eifa1

PDB Entry: 2eif (more details), 1.8 Å

PDB Description: Eukaryotic translation initiation factor 5A from Methanococcus jannaschii
PDB Compounds: (A:) protein (eukaryotic translation initiation factor 5a)

SCOPe Domain Sequences for d2eifa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eifa1 b.34.5.2 (A:4-73) Eukaryotic initiation translation factor 5a (eIF5a) {Methanococcus jannaschii [TaxId: 2190]}
mpgtkqvnvgslkvgqyvmidgvpceivdisvskpgkhggakarvvgigifekvkkefva
ptsskvevpi

SCOPe Domain Coordinates for d2eifa1:

Click to download the PDB-style file with coordinates for d2eifa1.
(The format of our PDB-style files is described here.)

Timeline for d2eifa1: