![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.2: eIF5a N-terminal domain-like [50110] (4 proteins) |
![]() | Protein Eukaryotic initiation translation factor 5a (eIF5a) [50111] (5 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [50112] (2 PDB entries) |
![]() | Domain d2eifa1: 2eif A:4-73 [24607] Other proteins in same PDB: d2eifa2, d2eifa3 |
PDB Entry: 2eif (more details), 1.8 Å
SCOPe Domain Sequences for d2eifa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eifa1 b.34.5.2 (A:4-73) Eukaryotic initiation translation factor 5a (eIF5a) {Methanococcus jannaschii [TaxId: 2190]} mpgtkqvnvgslkvgqyvmidgvpceivdisvskpgkhggakarvvgigifekvkkefva ptsskvevpi
Timeline for d2eifa1: