Lineage for d1ffkn_ (1ffk N:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295568Fold b.34: SH3-like barrel [50036] (13 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 295918Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) (S)
    many known members contain KOW motif
  5. 295919Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 295920Protein Ribosomal proteins L21e [50108] (1 species)
  7. 295921Species Archaeon Haloarcula marismortui [TaxId:2238] [50109] (12 PDB entries)
  8. 295926Domain d1ffkn_: 1ffk N: [24606]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_
    complexed with cd, k, mo3; mutant

Details for d1ffkn_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffkn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffkn_ b.34.5.1 (N:) Ribosomal proteins L21e {Archaeon Haloarcula marismortui}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOP Domain Coordinates for d1ffkn_:

Click to download the PDB-style file with coordinates for d1ffkn_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkn_: