Lineage for d1ffkq_ (1ffk Q:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227526Fold b.34: SH3-like barrel [50036] (12 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 227851Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) (S)
    many known members contain KOW motif
  5. 227852Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 227863Protein Ribosomal proteins L24 (L24p) [50106] (1 species)
  7. 227864Species Archaeon Haloarcula marismortui [TaxId:2238] [50107] (8 PDB entries)
  8. 227868Domain d1ffkq_: 1ffk Q: [24605]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_
    complexed with cd, k, mo3; mutant

Details for d1ffkq_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffkq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffkq_ b.34.5.1 (Q:) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOP Domain Coordinates for d1ffkq_:

Click to download the PDB-style file with coordinates for d1ffkq_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkq_: