![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (87 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [187193] (7 PDB entries) |
![]() | Domain d3f8na_: 3f8n A: [246042] automated match to d2o03a_ complexed with mn, zn |
PDB Entry: 3f8n (more details), 3.15 Å
SCOPe Domain Sequences for d3f8na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f8na_ a.4.5.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} helkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvynnl rvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahvtgf kvshhrleiygvcqecs
Timeline for d3f8na_: