Lineage for d3f8na_ (3f8n A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2307989Species Bacillus subtilis [TaxId:1423] [187193] (7 PDB entries)
  8. 2308010Domain d3f8na_: 3f8n A: [246042]
    automated match to d2o03a_
    complexed with mn, zn

Details for d3f8na_

PDB Entry: 3f8n (more details), 3.15 Å

PDB Description: Crystal structure of PerR-Zn-Mn
PDB Compounds: (A:) Peroxide operon regulator

SCOPe Domain Sequences for d3f8na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f8na_ a.4.5.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
helkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvynnl
rvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahvtgf
kvshhrleiygvcqecs

SCOPe Domain Coordinates for d3f8na_:

Click to download the PDB-style file with coordinates for d3f8na_.
(The format of our PDB-style files is described here.)

Timeline for d3f8na_: