Lineage for d1ahjh_ (1ahj H:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461193Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 461565Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) (S)
  5. 461587Family b.34.4.4: Nitrile hydratase beta chain [50101] (2 proteins)
    contains irregular array of helices in the N-terminal extension
  6. 461595Protein Iron-containing nitrile hydratase [50102] (1 species)
  7. 461596Species Rhodococcus erythropolis [50103] (2 PDB entries)
    also Rhodococcus sp. R312
  8. 461602Domain d1ahjh_: 1ahj H: [24604]
    Other proteins in same PDB: d1ahja_, d1ahjc_, d1ahje_, d1ahjg_

Details for d1ahjh_

PDB Entry: 1ahj (more details), 2.65 Å

PDB Description: nitrile hydratase

SCOP Domain Sequences for d1ahjh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahjh_ b.34.4.4 (H:) Iron-containing nitrile hydratase {Rhodococcus erythropolis}
mdgvhdlagvqgfgkvphtvdadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepaa

SCOP Domain Coordinates for d1ahjh_:

Click to download the PDB-style file with coordinates for d1ahjh_.
(The format of our PDB-style files is described here.)

Timeline for d1ahjh_: