SCOPe 2.07: Domain d3f7ha_: 3f7h A:

Lineage for d3f7ha_ (3f7h A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (48 PDB entries)

8. Domain d3f7ha_: 3f7h A: [246038]
   automated match to d1oxnb_
   complexed with 419, btb, edo, li, zn

Details for d3f7ha_

PDB Entry: 3f7h, 1.8 Å

PDB Description: structure of an ml-iap/xiap chimera bound to a peptidomimetic

PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 7

SCOPe Domain Sequences for d3f7ha_:

Sequence; same for both SEQRES and ATOM records:

>d3f7ha_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
ddpwtehakwfpgcqfllrskgqeyinnih

Timeline for d3f7ha_:

• d3f7ha_ first appeared in SCOPe 2.04
  
• d3f7ha_ appears in SCOPe 2.06
  
• d3f7ha_ appears in the current release, SCOPe 2.08