Lineage for d3f7gd_ (3f7g D:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642738Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2642739Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2642740Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2642874Protein automated matches [190700] (1 species)
    not a true protein
  7. 2642875Species Human (Homo sapiens) [TaxId:9606] [187840] (48 PDB entries)
  8. 2642938Domain d3f7gd_: 3f7g D: [246036]
    automated match to d1oxnb_
    complexed with 389, p33, zn

Details for d3f7gd_

PDB Entry: 3f7g (more details), 2.3 Å

PDB Description: structure of the bir domain from ml-iap bound to a peptidomimetic
PDB Compounds: (D:) Baculoviral IAP repeat-containing protein 7

SCOPe Domain Sequences for d3f7gd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f7gd_ g.52.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agatlsrgpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygg
lqswkrgddpwtehakwfpscqfllrskgrdfvhsvqeth

SCOPe Domain Coordinates for d3f7gd_:

Click to download the PDB-style file with coordinates for d3f7gd_.
(The format of our PDB-style files is described here.)

Timeline for d3f7gd_: