Lineage for d3f7gc_ (3f7g C:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1707316Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 1707317Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 1707318Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 1707452Protein automated matches [190700] (1 species)
    not a true protein
  7. 1707453Species Human (Homo sapiens) [TaxId:9606] [187840] (25 PDB entries)
  8. 1707478Domain d3f7gc_: 3f7g C: [246035]
    automated match to d1oxnb_
    complexed with 389, p33, zn

Details for d3f7gc_

PDB Entry: 3f7g (more details), 2.3 Å

PDB Description: structure of the bir domain from ml-iap bound to a peptidomimetic
PDB Compounds: (C:) Baculoviral IAP repeat-containing protein 7

SCOPe Domain Sequences for d3f7gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f7gc_ g.52.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agatlsrgpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygg
lqswkrgddpwtehakwfpscqfllrskgrdfvhsvqeths

SCOPe Domain Coordinates for d3f7gc_:

Click to download the PDB-style file with coordinates for d3f7gc_.
(The format of our PDB-style files is described here.)

Timeline for d3f7gc_: