Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
Protein Benzoylformate decarboxylase [52482] (1 species) |
Species Pseudomonas putida [TaxId:303] [52483] (34 PDB entries) Uniprot P20906 |
Domain d3f6ex2: 3f6e X:182-341 [246031] Other proteins in same PDB: d3f6ex1, d3f6ex3 automated match to d1q6za1 complexed with 8pa, mg |
PDB Entry: 3f6e (more details), 1.34 Å
SCOPe Domain Sequences for d3f6ex2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f6ex2 c.31.1.3 (X:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd pleaarapmgdaivadigamasalanlveessrqlptaap
Timeline for d3f6ex2: