SCOPe 2.04: Domain d3f6ex1: 3f6e X:2-181

Lineage for d3f6ex1 (3f6e X:2-181)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family
6. Protein automated matches [227126] (15 species)
   not a true protein
7. Species Pseudomonas putida [TaxId:303] [254984] (28 PDB entries)

8. Domain d3f6ex1: 3f6e X:2-181 [246030]
   Other proteins in same PDB: d3f6ex2
   automated match to d2fwna2
   complexed with 8pa, mg

Details for d3f6ex1

PDB Entry: 3f6e, 1.34 Å

PDB Description: crystal structure of benzoylformate decarboxylase in complex with the pyridyl inhibitor 3-pkb

PDB Compounds: (X:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d3f6ex1:

Sequence; same for both SEQRES and ATOM records:

>d3f6ex1 c.36.1.0 (X:2-181) automated matches {Pseudomonas putida [TaxId: 303]}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

Timeline for d3f6ex1:

• d3f6ex1 is new in SCOPe 2.04-stable
  
• d3f6ex1 appears in SCOPe 2.05
  
• d3f6ex1 appears in the current release, SCOPe 2.08