Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) |
Family b.34.4.4: Nitrile hydratase beta chain [50101] (2 proteins) contains irregular array of helices in the N-terminal extension |
Protein Iron-containing nitrile hydratase [50102] (1 species) |
Species Rhodococcus erythropolis [TaxId:1833] [50103] (16 PDB entries) also Rhodococcus sp. R312 |
Domain d1ahjf_: 1ahj F: [24603] Other proteins in same PDB: d1ahja_, d1ahjc_, d1ahje_, d1ahjg_ |
PDB Entry: 1ahj (more details), 2.65 Å
SCOP Domain Sequences for d1ahjf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahjf_ b.34.4.4 (F:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]} mdgvhdlagvqgfgkvphtvdadigptfhaewehlpyslmfagvaelgafsvdevryvve rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty hvkfaaeelfgsdtdggsvvvdlfegylepaa
Timeline for d1ahjf_: