Lineage for d1ahjf_ (1ahj F:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665462Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) (S)
  5. 665485Family b.34.4.4: Nitrile hydratase beta chain [50101] (2 proteins)
    contains irregular array of helices in the N-terminal extension
  6. 665495Protein Iron-containing nitrile hydratase [50102] (1 species)
  7. 665496Species Rhodococcus erythropolis [TaxId:1833] [50103] (8 PDB entries)
    also Rhodococcus sp. R312
  8. 665507Domain d1ahjf_: 1ahj F: [24603]
    Other proteins in same PDB: d1ahja_, d1ahjc_, d1ahje_, d1ahjg_

Details for d1ahjf_

PDB Entry: 1ahj (more details), 2.65 Å

PDB Description: nitrile hydratase
PDB Compounds: (F:) nitrile hydratase (subunit beta)

SCOP Domain Sequences for d1ahjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahjf_ b.34.4.4 (F:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvdadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepaa

SCOP Domain Coordinates for d1ahjf_:

Click to download the PDB-style file with coordinates for d1ahjf_.
(The format of our PDB-style files is described here.)

Timeline for d1ahjf_: