![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
![]() | Protein automated matches [191142] (6 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255824] (1 PDB entry) |
![]() | Domain d3f5ca_: 3f5c A: [246026] automated match to d2xhsa_ protein/DNA complex |
PDB Entry: 3f5c (more details), 3 Å
SCOPe Domain Sequences for d3f5ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f5ca_ a.123.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} asiphlilellkcepdepqvqakimaylqqeqsnrnrqeklsafgllckmadqtlfsive warssiffrelkvddqmkllqncwsellildhiyrqvahgkegtiflvtgehvdystiis htevafnnllslaqelvvrlrslqfdqrefvclkflvlfssdvknlenlqlvegvqeqvn aalldytvcnypqqtekfgqlllrlpelraiskqaedylyykhvngdvpynnlliemlha kra
Timeline for d3f5ca_: