Lineage for d3f5ca_ (3f5c A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2729960Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2729961Protein automated matches [191142] (5 species)
    not a true protein
  7. 2730183Species Mouse (Mus musculus) [TaxId:10090] [255824] (1 PDB entry)
  8. 2730184Domain d3f5ca_: 3f5c A: [246026]
    automated match to d2xhsa_
    protein/DNA complex

Details for d3f5ca_

PDB Entry: 3f5c (more details), 3 Å

PDB Description: structure of dax-1:lrh-1 complex
PDB Compounds: (A:) Nuclear receptor subfamily 5 group A member 2

SCOPe Domain Sequences for d3f5ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f5ca_ a.123.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
asiphlilellkcepdepqvqakimaylqqeqsnrnrqeklsafgllckmadqtlfsive
warssiffrelkvddqmkllqncwsellildhiyrqvahgkegtiflvtgehvdystiis
htevafnnllslaqelvvrlrslqfdqrefvclkflvlfssdvknlenlqlvegvqeqvn
aalldytvcnypqqtekfgqlllrlpelraiskqaedylyykhvngdvpynnlliemlha
kra

SCOPe Domain Coordinates for d3f5ca_:

Click to download the PDB-style file with coordinates for d3f5ca_.
(The format of our PDB-style files is described here.)

Timeline for d3f5ca_: