Class a: All alpha proteins [46456] (286 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.11: HMD dimerization domain-like [140777] (1 protein) dimer similar to those of the GDP-mannose 6-dehydrogenase and class I KARI domains automatically mapped to Pfam PF03201 |
Protein 5,10-methenyltetrahydromethanopterin hydrogenase, HMD [140778] (1 species) |
Species Methanocaldococcus jannaschii [TaxId:2190] [140779] (6 PDB entries) Uniprot Q58194 243-344 |
Domain d3f46a2: 3f46 A:243-345 [246025] Other proteins in same PDB: d3f46a1 automated match to d3f47a2 complexed with cmo, dtv, fe2, i2c |
PDB Entry: 3f46 (more details), 1.95 Å
SCOPe Domain Sequences for d3f46a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f46a2 a.100.1.11 (A:243-345) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Methanocaldococcus jannaschii [TaxId: 2190]} anligpvcdmcsavtatvyagllayrdavtkilgapadfaqmmadealtqihnlmkekgi anmeealdpaallgtadsmcfgplaeilptalkvlekhkvvee
Timeline for d3f46a2: