Lineage for d1ahjd_ (1ahj D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393361Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2393417Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
    contains irregular array of helices in the N-terminal extension
    automatically mapped to Pfam PF02211
  6. 2393427Protein Iron-containing nitrile hydratase [50102] (1 species)
  7. 2393428Species Rhodococcus erythropolis [TaxId:1833] [50103] (28 PDB entries)
    also Rhodococcus sp. R312
  8. 2393458Domain d1ahjd_: 1ahj D: [24602]
    Other proteins in same PDB: d1ahja_, d1ahjc_, d1ahje_, d1ahjg_
    complexed with fe

Details for d1ahjd_

PDB Entry: 1ahj (more details), 2.65 Å

PDB Description: nitrile hydratase
PDB Compounds: (D:) nitrile hydratase (subunit beta)

SCOPe Domain Sequences for d1ahjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahjd_ b.34.4.4 (D:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvdadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepaa

SCOPe Domain Coordinates for d1ahjd_:

Click to download the PDB-style file with coordinates for d1ahjd_.
(The format of our PDB-style files is described here.)

Timeline for d1ahjd_: