Lineage for d3f1ex_ (3f1e X:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1954570Fold e.38: Release factor [75619] (1 superfamily)
    4 domains: (1) 3-helical bundle; (2) alpha+beta of ferredoxin-like fold (3 and 4) alpha+beta of dsRDB-like fold
  4. 1954571Superfamily e.38.1: Release factor [75620] (2 families) (S)
  5. 1954584Family e.38.1.0: automated matches [191461] (1 protein)
    not a true family
  6. 1954585Protein automated matches [190712] (3 species)
    not a true protein
  7. 1954591Species Thermus thermophilus [TaxId:274] [187861] (3 PDB entries)
  8. 1954594Domain d3f1ex_: 3f1e X: [246014]
    protein/RNA complex; complexed with mg, zn
    protein/RNA complex; complexed with mg, zn

Details for d3f1ex_

PDB Entry: 3f1e (more details), 3 Å

PDB Description: Crystal structure of a translation termination complex formed with release factor RF2. This file contains the 30S subunit, RF2, two tRNA, and mRNA molecules of one 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (X:) Bacterial peptide chain release factor 2 (RF-2)

SCOPe Domain Sequences for d3f1ex_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f1ex_ e.38.1.0 (X:) automated matches {Thermus thermophilus [TaxId: 274]}
nasrnawkasggifdipqketrlkelerrledpslwndpeaarkvsqeaarlrrtvdtfr
slesdlqgllelmeelpaeerealkpeleeaakkldelyhqtllnfphaeknailtiqpg
aggteacdwaemllrmytrfaerqgfqvevvdltpgpeagidyaqilvkgenaygllspe
agvhrlvrpspfdasgrrhtsfagvevipevdeevevvlkpeelridvmrasgpggqgvn
ttdsavrvvhlptgitvtcqttrsqiknkelalkilkarlyelerkkreeelkalrgevr
piewgsqirsyvldknyvkdhrtglmrhdpenvldgdlmdliwaglewkagrrqgteeve
ae

SCOPe Domain Coordinates for d3f1ex_:

Click to download the PDB-style file with coordinates for d3f1ex_.
(The format of our PDB-style files is described here.)

Timeline for d3f1ex_: