Lineage for d3f0ma_ (3f0m A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008710Fold d.248: Coproporphyrinogen III oxidase [102885] (2 superfamilies)
    alpha-beta(6)-alpha(2)-beta-alpha(n); 3 layers alpha/beta/alpha; antiparallel sheet: order 1234567
  4. 3008751Superfamily d.248.2: Ferredoxin-dependent bilin reductase [254140] (1 family) (S)
    Pfam PF05996; PubMed 16380422; possibly related to (d.248.1) based on remote homology to chlorophyll catabolic enzimes discussed in PubMed 11283349
  5. 3008752Family d.248.2.1: Ferredoxin-dependent bilin reductase [254184] (2 proteins)
  6. 3008753Protein Ferredoxin-dependent bilin reductase [254408] (2 species)
  7. 3008758Species Synechocystis sp. [TaxId:1148] [254847] (12 PDB entries)
  8. 3008767Domain d3f0ma_: 3f0m A: [246013]
    automated match to d2d1ea_
    complexed with bla, edo

Details for d3f0ma_

PDB Entry: 3f0m (more details), 1.5 Å

PDB Description: crystal structure of radical d105n synechocystis sp. pcya
PDB Compounds: (A:) Phycocyanobilin:ferredoxin oxidoreductase

SCOPe Domain Sequences for d3f0ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f0ma_ d.248.2.1 (A:) Ferredoxin-dependent bilin reductase {Synechocystis sp. [TaxId: 1148]}
lsltnsslmptlnpmiqqlalaiaaswqslplkpyqlpedlgyvegrlegeklvienrcy
qtpqfrkmhlelakvgkgldilhcvmfpeplyglplfgcnivagpggvsaaiadlsptqs
drqlpaayqkslaelgqpefeqqrelppwgeifseyclfirpsnvteeerfvqrvvdflq
ihchqsivaeplseaqtlehrqgqihycqqqqkndktrrvlekafgeawaerymsqvlfd
viq

SCOPe Domain Coordinates for d3f0ma_:

Click to download the PDB-style file with coordinates for d3f0ma_.
(The format of our PDB-style files is described here.)

Timeline for d3f0ma_: