Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.248: Coproporphyrinogen III oxidase [102885] (2 superfamilies) alpha-beta(6)-alpha(2)-beta-alpha(n); 3 layers alpha/beta/alpha; antiparallel sheet: order 1234567 |
Superfamily d.248.2: Ferredoxin-dependent bilin reductase [254140] (1 family) Pfam PF05996; PubMed 16380422; possibly related to (d.248.1) based on remote homology to chlorophyll catabolic enzimes discussed in PubMed 11283349 |
Family d.248.2.1: Ferredoxin-dependent bilin reductase [254184] (2 proteins) |
Protein Ferredoxin-dependent bilin reductase [254408] (2 species) |
Species Synechocystis sp. [TaxId:1148] [254847] (12 PDB entries) |
Domain d3f0ma_: 3f0m A: [246013] automated match to d2d1ea_ complexed with bla, edo |
PDB Entry: 3f0m (more details), 1.5 Å
SCOPe Domain Sequences for d3f0ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f0ma_ d.248.2.1 (A:) Ferredoxin-dependent bilin reductase {Synechocystis sp. [TaxId: 1148]} lsltnsslmptlnpmiqqlalaiaaswqslplkpyqlpedlgyvegrlegeklvienrcy qtpqfrkmhlelakvgkgldilhcvmfpeplyglplfgcnivagpggvsaaiadlsptqs drqlpaayqkslaelgqpefeqqrelppwgeifseyclfirpsnvteeerfvqrvvdflq ihchqsivaeplseaqtlehrqgqihycqqqqkndktrrvlekafgeawaerymsqvlfd viq
Timeline for d3f0ma_: