Lineage for d1ahjb_ (1ahj B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58491Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) (S)
  5. 58511Family b.34.4.4: Nitrile hydratase beta chain [50101] (1 protein)
  6. 58512Protein Nitrile hydratase beta chain [50102] (1 species)
  7. 58513Species Rhodococcus erythropolis [50103] (2 PDB entries)
  8. 58516Domain d1ahjb_: 1ahj B: [24601]
    Other proteins in same PDB: d1ahja_, d1ahjc_, d1ahje_, d1ahjg_

Details for d1ahjb_

PDB Entry: 1ahj (more details), 2.65 Å

PDB Description: nitrile hydratase

SCOP Domain Sequences for d1ahjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahjb_ b.34.4.4 (B:) Nitrile hydratase beta chain {Rhodococcus erythropolis}
mdgvhdlagvqgfgkvphtvdadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepaa

SCOP Domain Coordinates for d1ahjb_:

Click to download the PDB-style file with coordinates for d1ahjb_.
(The format of our PDB-style files is described here.)

Timeline for d1ahjb_: