SCOP 1.71: Domain d2ahjd_: 2ahj D:

Lineage for d2ahjd_ (2ahj D:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families)

5. Family b.34.4.4: Nitrile hydratase beta chain [50101] (2 proteins)
   contains irregular array of helices in the N-terminal extension

6. Protein Iron-containing nitrile hydratase [50102] (1 species)

7. Species Rhodococcus erythropolis [50103] (2 PDB entries)
   also Rhodococcus sp. R312

8. Domain d2ahjd_: 2ahj D: [24600]
   Other proteins in same PDB: d2ahja_, d2ahjc_
   complexed with dio, fe, no, so4, zn

Details for d2ahjd_

PDB Entry: 2ahj, 1.7 Å

PDB Description: nitrile hydratase complexed with nitric oxide

SCOP Domain Sequences for d2ahjd_:

Sequence; same for both SEQRES and ATOM records:

>d2ahjd_ b.34.4.4 (D:) Iron-containing nitrile hydratase {Rhodococcus erythropolis}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepaa

Timeline for d2ahjd_:

• d2ahjd_ first appeared (with stable ids) in SCOP 1.55
  
• d2ahjd_ appears in SCOP 1.69
  
• d2ahjd_ appears in SCOP 1.73
  
• d2ahjd_ appears in the current release, SCOPe 2.08