SCOPe 2.04: Domain d3eylb_: 3eyl B:

Lineage for d3eylb_ (3eyl B:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein BIR domains of XIAP [57928] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries)
   Uniprot P98170 241-356

8. Domain d3eylb_: 3eyl B: [245993]
   automated match to d1tfqa_
   complexed with smk, zn

Details for d3eylb_

PDB Entry: 3eyl, 3 Å

PDB Description: Crystal structure of XIAP BIR3 domain in complex with a Smac-mimetic compound

PDB Compounds: (B:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d3eylb_:

Sequence; same for both SEQRES and ATOM records:

>d3eylb_ g.52.1.1 (B:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
edpweqhakwypgckylleqkgqeyinnihlthsleeclvr

Timeline for d3eylb_:

• d3eylb_ is new in SCOPe 2.04-stable
  
• d3eylb_ appears in SCOPe 2.05
  
• d3eylb_ appears in the current release, SCOPe 2.08