Lineage for d2ahjb_ (2ahj B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2054490Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2054528Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
    contains irregular array of helices in the N-terminal extension
    automatically mapped to Pfam PF02211
  6. 2054538Protein Iron-containing nitrile hydratase [50102] (1 species)
  7. 2054539Species Rhodococcus erythropolis [TaxId:1833] [50103] (28 PDB entries)
    also Rhodococcus sp. R312
  8. 2054562Domain d2ahjb_: 2ahj B: [24599]
    Other proteins in same PDB: d2ahja_, d2ahjc_
    complexed with dio, fe, no, so4, zn

Details for d2ahjb_

PDB Entry: 2ahj (more details), 1.7 Å

PDB Description: nitrile hydratase complexed with nitric oxide
PDB Compounds: (B:) nitrile hydratase

SCOPe Domain Sequences for d2ahjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahjb_ b.34.4.4 (B:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepa

SCOPe Domain Coordinates for d2ahjb_:

Click to download the PDB-style file with coordinates for d2ahjb_.
(The format of our PDB-style files is described here.)

Timeline for d2ahjb_: