SCOP 1.75: Domain d2ahjb_: 2ahj B:

Lineage for d2ahjb_ (2ahj B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families)

5. Family b.34.4.4: Nitrile hydratase beta chain [50101] (2 proteins)
   contains irregular array of helices in the N-terminal extension

6. Protein Iron-containing nitrile hydratase [50102] (1 species)

7. Species Rhodococcus erythropolis [TaxId:1833] [50103] (16 PDB entries)
   also Rhodococcus sp. R312

8. Domain d2ahjb_: 2ahj B: [24599]
   Other proteins in same PDB: d2ahja_, d2ahjc_

Details for d2ahjb_

PDB Entry: 2ahj, 1.7 Å

PDB Description: nitrile hydratase complexed with nitric oxide

PDB Compounds: (B:) nitrile hydratase

SCOP Domain Sequences for d2ahjb_:

Sequence; same for both SEQRES and ATOM records:

>d2ahjb_ b.34.4.4 (B:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepa

Timeline for d2ahjb_:

• d2ahjb_ first appeared (with stable ids) in SCOP 1.55
  
• d2ahjb_ appears in SCOP 1.73
  
• d2ahjb_ appears in SCOPe 2.01
  
• d2ahjb_ appears in the current release, SCOPe 2.08