SCOPe 2.04: Domain d3ey4b_: 3ey4 B:

Lineage for d3ey4b_ (3ey4 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117424] (26 PDB entries)
   Uniprot P28845

8. Domain d3ey4b_: 3ey4 B: [245989]
   automated match to d3pdjb_
   complexed with 352, ndp

Details for d3ey4b_

PDB Entry: 3ey4, 3 Å

PDB Description: further studies with the 2-amino-1,3-thiazol-4(5h)-one class of 11- hydroxysteroid dehydrogenase type 1 (11-hsd1) inhibitors: reducing pregnane x receptor (pxr) activity and exploring activity in a monkey pharmacodynamic model

PDB Compounds: (B:) 11-beta-hydroxysteroid dehydrogenase 1

SCOPe Domain Sequences for d3ey4b_:

Sequence; same for both SEQRES and ATOM records:

>d3ey4b_ c.2.1.2 (B:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
frpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaasa
hyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfls
yvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsrv
nvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwttl
lirnpsrkileflys

Timeline for d3ey4b_:

• d3ey4b_ is new in SCOPe 2.04-stable
  
• d3ey4b_ appears in SCOPe 2.05
  
• d3ey4b_ appears in the current release, SCOPe 2.08