SCOPe 2.05: Domain d3exgf1: 3exg F:1-191

Lineage for d3exgf1 (3exg F:1-191)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
   automatically mapped to Pfam PF02779

6. Protein E1-beta subunit of pyruvate dehydrogenase, Pyr module [69472] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89653] (4 PDB entries)

8. Domain d3exgf1: 3exg F:1-191 [245956]
   Other proteins in same PDB: d3exg1_, d3exg22, d3exg3_, d3exg42, d3exg5_, d3exg62, d3exga_, d3exgb2, d3exgc_, d3exgd2, d3exge_, d3exgf2, d3exgg_, d3exgh2, d3exgi_, d3exgj2, d3exgk_, d3exgl2, d3exgm_, d3exgn2, d3exgo_, d3exgp2, d3exgq_, d3exgr2, d3exgs_, d3exgt2, d3exgu_, d3exgv2, d3exgw_, d3exgx2, d3exgy_, d3exgz2
   automated match to d2ozlb1
   complexed with k

Details for d3exgf1

PDB Entry: 3exg, 3.01 Å

PDB Description: crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex

PDB Compounds: (F:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d3exgf1:

Sequence; same for both SEQRES and ATOM records:

>d3exgf1 c.36.1.7 (F:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
efppeaqskdf

Timeline for d3exgf1:

• d3exgf1 first appeared in SCOPe 2.04
  
• d3exgf1 appears in SCOPe 2.06
  
• d3exgf1 appears in the current release, SCOPe 2.08