Lineage for d1psea_ (1pse A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783741Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2783757Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (2 proteins)
    automatically mapped to Pfam PF02427
  6. 2783758Protein Photosystem I accessory protein E (PsaE) [50095] (5 species)
  7. 2783764Species Synechococcus sp., pcc 7002 [TaxId:1131] [50096] (2 PDB entries)
  8. 2783765Domain d1psea_: 1pse A: [24595]

Details for d1psea_

PDB Entry: 1pse (more details)

PDB Description: the three-dimensional solution structure of psae from the cyanobacterium synechococcus sp. strain pcc 7002: a photosystem i protein that shows structural homology with sh3 domains
PDB Compounds: (A:) photosystem I accessory protein e

SCOPe Domain Sequences for d1psea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1psea_ b.34.4.2 (A:) Photosystem I accessory protein E (PsaE) {Synechococcus sp., pcc 7002 [TaxId: 1131]}
aiergskvkilrkesywygdvgtvasidksgiiypvivrfnkvnyngfsgsagglntnnf
aehelevvg

SCOPe Domain Coordinates for d1psea_:

Click to download the PDB-style file with coordinates for d1psea_.
(The format of our PDB-style files is described here.)

Timeline for d1psea_: