Lineage for d3exg31 (3exg 3:1-361)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108723Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 protein domains)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 2108757Protein E1-beta subunit of pyruvate dehydrogenase (PP module) [89651] (1 species)
  7. 2108758Species Human (Homo sapiens) [TaxId:9606] [89652] (7 PDB entries)
  8. 2108777Domain d3exg31: 3exg 3:1-361 [245943]
    Other proteins in same PDB: d3exg12, d3exg21, d3exg22, d3exg32, d3exg41, d3exg42, d3exg52, d3exg61, d3exg62, d3exga2, d3exgb1, d3exgb2, d3exgc2, d3exgd1, d3exgd2, d3exge2, d3exgf1, d3exgf2, d3exgg2, d3exgh1, d3exgh2, d3exgi2, d3exgj1, d3exgj2, d3exgk2, d3exgl1, d3exgl2, d3exgm2, d3exgn1, d3exgn2, d3exgo2, d3exgp1, d3exgp2, d3exgq2, d3exgr1, d3exgr2, d3exgt1, d3exgt2, d3exgu2, d3exgv1, d3exgv2, d3exgw2, d3exgx1, d3exgx2, d3exgy2, d3exgz1, d3exgz2
    automated match to d3exia_
    complexed with k

Details for d3exg31

PDB Entry: 3exg (more details), 3.01 Å

PDB Description: crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex
PDB Compounds: (3:) Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial

SCOPe Domain Sequences for d3exg31:

Sequence, based on SEQRES records: (download)

>d3exg31 c.36.1.11 (3:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]}
fandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiirg
fchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakgk
ggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeayn
maalwklpcificennrygmgtaveraaastdyykrgdfipglrvdgmdilcvreatrfa
aaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiqevrsksdpimllkdrmvnsnl
asveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksv
s

Sequence, based on observed residues (ATOM records): (download)

>d3exg31 c.36.1.11 (3:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]}
fandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiirg
fchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakgk
ggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeayn
maalwklpcificennreraaastdyykrgdfipglrvdgmdilcvreatrfaaaycrsg
kgpilmelqtyrytreeiqevrsksdpimllkdrmvnsnlasveelkeidvevrkeieda
aqfatadpeppleelgyhiyssdppfevrganqwikfksvs

SCOPe Domain Coordinates for d3exg31:

Click to download the PDB-style file with coordinates for d3exg31.
(The format of our PDB-style files is described here.)

Timeline for d3exg31:

View in 3D
Domains from same chain:
(mouse over for more information)
d3exg32
View in 3D
Domains from other chains:
(mouse over for more information)
d3exg11, d3exg12, d3exg21, d3exg22, d3exg41, d3exg42, d3exg51, d3exg52, d3exg61, d3exg62, d3exga1, d3exga2, d3exgb1, d3exgb2, d3exgc1, d3exgc2, d3exgd1, d3exgd2, d3exge1, d3exge2, d3exgf1, d3exgf2, d3exgg1, d3exgg2, d3exgh1, d3exgh2, d3exgi1, d3exgi2, d3exgj1, d3exgj2, d3exgk1, d3exgk2, d3exgl1, d3exgl2, d3exgm1, d3exgm2, d3exgn1, d3exgn2, d3exgo1, d3exgo2, d3exgp1, d3exgp2, d3exgq1, d3exgq2, d3exgr1, d3exgr2, d3exgs_, d3exgt1, d3exgt2, d3exgu1, d3exgu2, d3exgv1, d3exgv2, d3exgw1, d3exgw2, d3exgx1, d3exgx2, d3exgy1, d3exgy2, d3exgz1, d3exgz2