Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) |
Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (2 proteins) automatically mapped to Pfam PF02427 |
Protein Photosystem I accessory protein E (PsaE) [50095] (5 species) |
Species Synechococcus sp., pcc 7002 [TaxId:1131] [50096] (2 PDB entries) |
Domain d1psfa_: 1psf A: [24594] |
PDB Entry: 1psf (more details)
SCOPe Domain Sequences for d1psfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1psfa_ b.34.4.2 (A:) Photosystem I accessory protein E (PsaE) {Synechococcus sp., pcc 7002 [TaxId: 1131]} aiergskvkilrkesywygdvgtvasidksgiiypvivrfnkvnyngfsgsagglntnnf aehelevvg
Timeline for d1psfa_: