SCOPe 2.07: Domain d1psfa_: 1psf A:

Lineage for d1psfa_ (1psf A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (2 proteins)
   automatically mapped to Pfam PF02427

6. Protein Photosystem I accessory protein E (PsaE) [50095] (5 species)

7. Species Synechococcus sp., pcc 7002 [TaxId:1131] [50096] (2 PDB entries)

8. Domain d1psfa_: 1psf A: [24594]

Details for d1psfa_

PDB Entry: 1psf

PDB Description: the three-dimensional solution structure of psae from the cyanobacterium synechococcus sp. strain pcc 7002: a photosystem i protein that shows structural homology with sh3 domains

PDB Compounds: (A:) photosystem I accessory protein e

SCOPe Domain Sequences for d1psfa_:

Sequence; same for both SEQRES and ATOM records:

>d1psfa_ b.34.4.2 (A:) Photosystem I accessory protein E (PsaE) {Synechococcus sp., pcc 7002 [TaxId: 1131]}
aiergskvkilrkesywygdvgtvasidksgiiypvivrfnkvnyngfsgsagglntnnf
aehelevvg

Timeline for d1psfa_:

• d1psfa_ first appeared (with stable ids) in SCOP 1.55, called d1psf__
  
• d1psfa_ appears in SCOPe 2.06
  
• d1psfa_ appears in the current release, SCOPe 2.08