SCOPe 2.08: Domain d3exff2: 3exf F:192-329

Lineage for d3exff2 (3exf F:192-329)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families)

5. Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins)
   automatically mapped to Pfam PF02780

6. Protein E1-beta subunit of pyruvate dehydrogenase, C-domain [69521] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89713] (9 PDB entries)

8. Domain d3exff2: 3exf F:192-329 [245936]
   Other proteins in same PDB: d3exfa1, d3exfa2, d3exfb1, d3exfc1, d3exfc2, d3exfd1, d3exfe1, d3exfe2, d3exff1, d3exfg1, d3exfg2, d3exfh1
   automated match to d2ozlb2
   complexed with k, mg, tpp

Details for d3exff2

PDB Entry: 3exf, 3 Å

PDB Description: crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex

PDB Compounds: (F:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d3exff2:

Sequence; same for both SEQRES and ATOM records:

>d3exff2 c.48.1.2 (F:192-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
lipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrtirpmdmetiea
svmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadvpmpyakiledn
sipqvkdiifaikktlni

Timeline for d3exff2:

• d3exff2 first appeared in SCOPe 2.04
  
• d3exff2 appears in SCOPe 2.07