Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins) automatically mapped to Pfam PF02780 |
Protein E1-beta subunit of pyruvate dehydrogenase, C-domain [69521] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [89713] (7 PDB entries) |
Domain d3exfd2: 3exf D:192-329 [245933] Other proteins in same PDB: d3exfa_, d3exfb1, d3exfc_, d3exfd1, d3exfe_, d3exff1, d3exfg_, d3exfh1 automated match to d2ozlb2 complexed with k, mg, tpp |
PDB Entry: 3exf (more details), 3 Å
SCOPe Domain Sequences for d3exfd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3exfd2 c.48.1.2 (D:192-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} lipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrtirpmdmetiea svmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadvpmpyakiledn sipqvkdiifaikktlni
Timeline for d3exfd2: