Lineage for d3exfb1 (3exf B:1-191)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2864755Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
    automatically mapped to Pfam PF02779
  6. 2864793Protein E1-beta subunit of pyruvate dehydrogenase, Pyr module [69472] (2 species)
  7. 2864794Species Human (Homo sapiens) [TaxId:9606] [89653] (4 PDB entries)
  8. 2864799Domain d3exfb1: 3exf B:1-191 [245929]
    Other proteins in same PDB: d3exfa1, d3exfa2, d3exfb2, d3exfc1, d3exfc2, d3exfd2, d3exfe1, d3exfe2, d3exff2, d3exfg1, d3exfg2, d3exfh2
    automated match to d2ozlb1
    complexed with k, mg, tpp

Details for d3exfb1

PDB Entry: 3exf (more details), 3 Å

PDB Description: crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex
PDB Compounds: (B:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d3exfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3exfb1 c.36.1.7 (B:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
efppeaqskdf

SCOPe Domain Coordinates for d3exfb1:

Click to download the PDB-style file with coordinates for d3exfb1.
(The format of our PDB-style files is described here.)

Timeline for d3exfb1: