Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (3 families) |
Family c.50.1.0: automated matches [191326] (1 protein) not a true family |
Protein automated matches [190146] (9 species) not a true protein |
Species Human coronavirus 229E [TaxId:11137] [225531] (3 PDB entries) |
Domain d3ewra_: 3ewr A: [245927] automated match to d3ewqa_ protein/RNA complex; complexed with apr |
PDB Entry: 3ewr (more details), 2.01 Å
SCOPe Domain Sequences for d3ewra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ewra_ c.50.1.0 (A:) automated matches {Human coronavirus 229E [TaxId: 11137]} keklnaflvhdnvafyqgdvdtvvngvdfdfivnaanenlahggglakaldvytkgklqr lskehiglagkvkvgtgvmvecdslrifnvvgprkgkherdllikayntinneqgtpltp ilscgifgikletslevlldvcntkevkvfvytdtevckvkdfvsgl
Timeline for d3ewra_: