Lineage for d3ewra_ (3ewr A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856004Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 1856005Superfamily c.50.1: Macro domain-like [52949] (3 families) (S)
  5. 1856124Family c.50.1.0: automated matches [191326] (1 protein)
    not a true family
  6. 1856125Protein automated matches [190146] (9 species)
    not a true protein
  7. 1856142Species Human coronavirus 229E [TaxId:11137] [225531] (3 PDB entries)
  8. 1856144Domain d3ewra_: 3ewr A: [245927]
    automated match to d3ewqa_
    protein/RNA complex; complexed with apr

Details for d3ewra_

PDB Entry: 3ewr (more details), 2.01 Å

PDB Description: complex of substrate ADP-ribose with HCoV-229E Nsp3 ADRP domain
PDB Compounds: (A:) non-structural protein 3

SCOPe Domain Sequences for d3ewra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ewra_ c.50.1.0 (A:) automated matches {Human coronavirus 229E [TaxId: 11137]}
keklnaflvhdnvafyqgdvdtvvngvdfdfivnaanenlahggglakaldvytkgklqr
lskehiglagkvkvgtgvmvecdslrifnvvgprkgkherdllikayntinneqgtpltp
ilscgifgikletslevlldvcntkevkvfvytdtevckvkdfvsgl

SCOPe Domain Coordinates for d3ewra_:

Click to download the PDB-style file with coordinates for d3ewra_.
(The format of our PDB-style files is described here.)

Timeline for d3ewra_: