SCOPe 2.06: Domain d3ewpb_: 3ewp B:

Lineage for d3ewpb_ (3ewp B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.0: automated matches [191326] (1 protein)
   not a true family

6. Protein automated matches [190146] (11 species)
   not a true protein

7. Species Avian infectious bronchitis virus [TaxId:11120] [232123] (2 PDB entries)

8. Domain d3ewpb_: 3ewp B: [245926]
   Other proteins in same PDB: d3ewpa2
   automated match to d3ewoa_
   protein/RNA complex; complexed with apr

Details for d3ewpb_

PDB Entry: 3ewp, 2 Å

PDB Description: complex of substrate ADP-ribose with IBV Nsp3 ADRP domain

PDB Compounds: (B:) non-structural protein 3

SCOPe Domain Sequences for d3ewpb_:

Sequence; same for both SEQRES and ATOM records:

>d3ewpb_ c.50.1.0 (B:) automated matches {Avian infectious bronchitis virus [TaxId: 11120]}
ekpkfleyktcvgdlavviakaldefkefcivnaanehmshgggvakaiadfcgpdfvey
cadyvkkhgpqqklvtpsfvkgiqcvnnvvgprhgdsnlreklvaayksvlvggvvnyvv
pvlssgifgvdfkisidamreafkgcairvllfslsqehidyfdatck

Timeline for d3ewpb_:

• d3ewpb_ first appeared in SCOPe 2.04
  
• d3ewpb_ appears in SCOPe 2.05
  
• d3ewpb_ appears in SCOPe 2.07
  
• d3ewpb_ appears in the current release, SCOPe 2.08