Class b: All beta proteins [48724] (144 folds) |
Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) |
Family b.34.4.1: R67 dihydrofolate reductase [50091] (1 protein) |
Protein R67 dihydrofolate reductase [50092] (1 species) |
Species Escherichia coli, plasmid PLZ1 [TaxId:562] [50093] (2 PDB entries) |
Domain d1vie__: 1vie - [24592] |
PDB Entry: 1vie (more details), 1.7 Å
SCOP Domain Sequences for d1vie__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vie__ b.34.4.1 (-) R67 dihydrofolate reductase {Escherichia coli, plasmid PLZ1} psnatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin
Timeline for d1vie__: