Lineage for d3eu1b_ (3eu1 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1978657Protein automated matches [190359] (42 species)
    not a true protein
  7. 1978839Species Goat (Capra hircus) [TaxId:9925] [188635] (3 PDB entries)
  8. 1978853Domain d3eu1b_: 3eu1 B: [245919]
    automated match to d3d1ab_
    complexed with hem

Details for d3eu1b_

PDB Entry: 3eu1 (more details), 3 Å

PDB Description: crystal structure determination of goat hemoglobin (capra hircus) at 3 angstrom resolution
PDB Compounds: (B:) Hemoglobin subunit beta-A

SCOPe Domain Sequences for d3eu1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eu1b_ a.1.1.2 (B:) automated matches {Goat (Capra hircus) [TaxId: 9925]}
mltaeekaavtgfwgkvkvdevgaealgrllvvypwtqrffehfgdlssadavmnnakvk
ahgkkvldsfsngmkhlddlkgtfaqlselhcdklhvdpenfkllgnvlvvvlarhhgse
ftpllqaefqkvvagvanalahryh

SCOPe Domain Coordinates for d3eu1b_:

Click to download the PDB-style file with coordinates for d3eu1b_.
(The format of our PDB-style files is described here.)

Timeline for d3eu1b_: