Lineage for d3etee2 (3ete E:209-498)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106264Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2106548Protein automated matches [227005] (3 species)
    not a true protein
  7. 2106549Species Cow (Bos taurus) [TaxId:9913] [225674] (3 PDB entries)
  8. 2106566Domain d3etee2: 3ete E:209-498 [245915]
    Other proteins in same PDB: d3etea1, d3eteb1, d3etec1, d3eted1, d3etee1, d3etef1
    automated match to d3etda2
    complexed with glu, gtp, h3p, ndp

Details for d3etee2

PDB Entry: 3ete (more details), 3 Å

PDB Description: crystal structure of bovine glutamate dehydrogenase complexed with hexachlorophene
PDB Compounds: (E:) glutamate dehydrogenase

SCOPe Domain Sequences for d3etee2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etee2 c.2.1.7 (E:209-498) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagv

SCOPe Domain Coordinates for d3etee2:

Click to download the PDB-style file with coordinates for d3etee2.
(The format of our PDB-style files is described here.)

Timeline for d3etee2: