| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
| Protein automated matches [227005] (6 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [225674] (6 PDB entries) |
| Domain d3etee2: 3ete E:209-498 [245915] Other proteins in same PDB: d3etea1, d3eteb1, d3etec1, d3eted1, d3etee1, d3etef1 automated match to d3etda2 complexed with glu, gtp, h3p, ndp |
PDB Entry: 3ete (more details), 3 Å
SCOPe Domain Sequences for d3etee2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3etee2 c.2.1.7 (E:209-498) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagv
Timeline for d3etee2: