SCOPe 2.05: Domain d3etec1: 3ete C:4-208

Lineage for d3etec1 (3ete C:4-208)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
   dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet

6. Protein automated matches [227004] (2 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [225673] (3 PDB entries)

8. Domain d3etec1: 3ete C:4-208 [245910]
   Other proteins in same PDB: d3etea2, d3eteb2, d3etec2, d3eted2, d3etee2, d3etef2
   automated match to d3etda1
   complexed with glu, gtp, h3p, ndp

Details for d3etec1

PDB Entry: 3ete, 3 Å

PDB Description: crystal structure of bovine glutamate dehydrogenase complexed with hexachlorophene

PDB Compounds: (C:) glutamate dehydrogenase

SCOPe Domain Sequences for d3etec1:

Sequence; same for both SEQRES and ATOM records:

>d3etec1 c.58.1.1 (C:4-208) automated matches {Cow (Bos taurus) [TaxId: 9913]}
eddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvlslsf
pirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfg
gakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswiadty
astighydinahacvtgkpisqggi

Timeline for d3etec1:

• d3etec1 first appeared in SCOPe 2.04
  
• d3etec1 appears in SCOPe 2.06
  
• d3etec1 appears in the current release, SCOPe 2.08