SCOPe 2.01: Domain d1mnda1: 1mnd A:34-79

Lineage for d1mnda1 (1mnd A:34-79)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries)

8. Domain d1mnda1: 1mnd A:34-79 [24591]
   Other proteins in same PDB: d1mnda2
   complexed with adp, alf, mg

Details for d1mnda1

PDB Entry: 1mnd, 2.6 Å

PDB Description: truncated head of myosin from dictyostelium discoideum complexed with mgadp-alf4

PDB Compounds: (A:) myosin

SCOPe Domain Sequences for d1mnda1:

Sequence, based on SEQRES records:

>d1mnda1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
yiwynpdpderdsyecgeivsetsdsftfktvdgqdrqvkkddanq

Sequence, based on observed residues (ATOM records):

>d1mnda1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
yiwynpdpderdsyecgeivsetsdsftfktvqdrqvkkddanq

Timeline for d1mnda1:

• d1mnda1 first appeared (with stable ids) in SCOP 1.55, called d1mnd_1
  
• d1mnda1 appears in SCOP 1.75
  
• d1mnda1 appears in SCOPe 2.02
  
• d1mnda1 appears in the current release, SCOPe 2.08