Lineage for d1mnd_1 (1mnd 34-79)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13205Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 13206Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 13207Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)
  7. 13229Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (16 PDB entries)
  8. 13245Domain d1mnd_1: 1mnd 34-79 [24591]
    Other proteins in same PDB: d1mnd_2

Details for d1mnd_1

PDB Entry: 1mnd (more details), 2.6 Å

PDB Description: truncated head of myosin from dictyostelium discoideum complexed with mgadp-alf4

SCOP Domain Sequences for d1mnd_1:

Sequence, based on SEQRES records: (download)

>d1mnd_1 b.34.3.1 (34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
yiwynpdpderdsyecgeivsetsdsftfktvdgqdrqvkkddanq

Sequence, based on observed residues (ATOM records): (download)

>d1mnd_1 b.34.3.1 (34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
yiwynpdpderdsyecgeivsetsdsftfktvqdrqvkkddanq

SCOP Domain Coordinates for d1mnd_1:

Click to download the PDB-style file with coordinates for d1mnd_1.
(The format of our PDB-style files is described here.)

Timeline for d1mnd_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mnd_2