Lineage for d3erba2 (3erb A:68-128)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034014Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 3034015Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 3034310Family g.18.1.0: automated matches [254264] (1 protein)
    not a true family
  6. 3034311Protein automated matches [254611] (1 species)
    not a true protein
  7. 3034312Species Human (Homo sapiens) [TaxId:9606] [255500] (8 PDB entries)
  8. 3034314Domain d3erba2: 3erb A:68-128 [245904]
    automated match to d2ok5a3

Details for d3erba2

PDB Entry: 3erb (more details), 1.8 Å

PDB Description: The Crystal Structure of C2b, a Fragment of Complement Component C2 produced during C3-convertase Formation
PDB Compounds: (A:) Complement C2

SCOPe Domain Sequences for d3erba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3erba2 g.18.1.0 (A:68-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcpapvsfengiytprlgsypvggnvsfecedgfilrgspvrqcrpngmwdgetavcdng
a

SCOPe Domain Coordinates for d3erba2:

Click to download the PDB-style file with coordinates for d3erba2.
(The format of our PDB-style files is described here.)

Timeline for d3erba2: